PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000099G0140
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family TCP
Protein Properties Length: 289aa    MW: 31107.7 Da    PI: 7.0626
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000099G0140genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP95.41.1e-2962132373
              TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                      g+kdrhsk+ T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WLl++a ++i++l+ ++++++  +
  PH01000099G0140  62 GGKDRHSKVKTVKGLRDRRVRLSVPTAIQLYDLQDRLGLNQPSKVVDWLLNAARHEIDKLPPLQFPPQDLM 132
                      78*************************************************************99998333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036344.2E-2763125IPR005333Transcription factor, TCP
PROSITE profilePS5136929.95163121IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MSGVQWVVDD ERRRVRVISG SQQQPTTEEE EAEELTRKHT AAVAMSRQWS AQTESRIVRV  60
FGGKDRHSKV KTVKGLRDRR VRLSVPTAIQ LYDLQDRLGL NQPSKVVDWL LNAARHEIDK  120
LPPLQFPPQD LMSHLPSSMP LTHDEKFGHI AAAAALAADG VKASGGDDVD GSGAHHMGRF  180
PAGGYHRFVG LNNSLGMVST AMPYNYTGES WNNSSVHESG AGSPQVAAAA AAAAAAHHTP  240
FPSLLSLAPG SHQLVYYSSE AEQFPVDNLG SQSLSLSSVR AFHDQTGS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0855481e-109BT085548.1 Zea mays full-length cDNA clone ZM_BFc0031O04 mRNA, complete cds.
GenBankBT0858131e-109BT085813.1 Zea mays full-length cDNA clone ZM_BFc0067G09 mRNA, complete cds.
GenBankBT0862231e-109BT086223.1 Zea mays full-length cDNA clone ZM_BFc0133E08 mRNA, complete cds.
GenBankEU9702171e-109EU970217.1 Zea mays clone 342355 TCP family transcription factor containing protein mRNA, complete cds.
GenBankKJ7280081e-109KJ728008.1 Zea mays clone pUT6143 TCP transcription factor (TCP30) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626531.11e-119PREDICTED: transcription factor PCF6-like
RefseqXP_015626542.11e-119PREDICTED: transcription factor PCF6-like
TrEMBLA0A0A9B7Y01e-125A0A0A9B7Y0_ARUDO; Uncharacterized protein
STRINGBGIOSGA000770-PA1e-119(Oryza sativa Indica Group)
STRINGLOC_Os01g55750.11e-119(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24903584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.17e-38TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5